RBM26 polyclonal antibody
  • RBM26 polyclonal antibody

RBM26 polyclonal antibody

Ref: AB-PAB23478
RBM26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM26.
Información adicional
Size 100 uL
Gene Name RBM26
Gene Alias ARRS2|C13orf10|FLJ20957|MGC133295|MGC133296|PRO1777|RP11-255E21.1|SE70-2|ZC3H17
Gene Description RNA binding motif protein 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64062
Iso type IgG

Enviar un mensaje


RBM26 polyclonal antibody

RBM26 polyclonal antibody