FAM216B polyclonal antibody
  • FAM216B polyclonal antibody

FAM216B polyclonal antibody

Ref: AB-PAB23475
FAM216B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM216B.
Información adicional
Size 100 uL
Gene Name FAM216B
Gene Alias RP11-366O17.1|C13orf30
Gene Description family with sequence similarity 216, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM216B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 144809
Iso type IgG

Enviar un mensaje


FAM216B polyclonal antibody

FAM216B polyclonal antibody