RSRC2 polyclonal antibody
  • RSRC2 polyclonal antibody

RSRC2 polyclonal antibody

Ref: AB-PAB23473
RSRC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RSRC2.
Información adicional
Size 100 uL
Gene Name RSRC2
Gene Alias FLJ11021
Gene Description arginine/serine-rich coiled-coil 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KKEGDKSQSAEIWEKLNFGNKDQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARSQTHTQRGMGLGFT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RSRC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65117
Iso type IgG

Enviar un mensaje


RSRC2 polyclonal antibody

RSRC2 polyclonal antibody