ANKRD33 polyclonal antibody
  • ANKRD33 polyclonal antibody

ANKRD33 polyclonal antibody

Ref: AB-PAB23471
ANKRD33 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD33.
Información adicional
Size 100 uL
Gene Name ANKRD33
Gene Alias C12orf7|DKFZp686O1689
Gene Description ankyrin repeat domain 33
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKSVPELLGTAPPPPLVPQSPPGSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSPSGHQSLALPLW
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD33.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 341405
Iso type IgG

Enviar un mensaje


ANKRD33 polyclonal antibody

ANKRD33 polyclonal antibody