SLC10A7 polyclonal antibody
  • SLC10A7 polyclonal antibody

SLC10A7 polyclonal antibody

Ref: AB-PAB23468
SLC10A7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC10A7.
Información adicional
Size 100 uL
Gene Name SLC10A7
Gene Alias C4orf13|DKFZp313H0531|DKFZp566M114|DKFZp779O2438|MGC25043|P7
Gene Description solute carrier family 10 (sodium/bile acid cotransporter family), member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC10A7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84068
Iso type IgG

Enviar un mensaje


SLC10A7 polyclonal antibody

SLC10A7 polyclonal antibody