C15orf39 polyclonal antibody
  • C15orf39 polyclonal antibody

C15orf39 polyclonal antibody

Ref: AB-PAB23467
C15orf39 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C15orf39.
Información adicional
Size 100 uL
Gene Name C15orf39
Gene Alias DKFZp434H132|FLJ46337|MGC117209
Gene Description chromosome 15 open reading frame 39
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LCDAISGSVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAGAIFVPIHLVKERLFPRLPPASVDHVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C15orf39.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56905
Iso type IgG

Enviar un mensaje


C15orf39 polyclonal antibody

C15orf39 polyclonal antibody