TIMM10 polyclonal antibody
  • TIMM10 polyclonal antibody

TIMM10 polyclonal antibody

Ref: AB-PAB23466
TIMM10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIMM10.
Información adicional
Size 100 uL
Gene Name TIMM10
Gene Alias TIM10|TIM10A
Gene Description translocase of inner mitochondrial membrane 10 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIMM10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26519
Iso type IgG

Enviar un mensaje


TIMM10 polyclonal antibody

TIMM10 polyclonal antibody