BCDIN3D polyclonal antibody
  • BCDIN3D polyclonal antibody

BCDIN3D polyclonal antibody

Ref: AB-PAB23458
BCDIN3D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCDIN3D.
Información adicional
Size 100 uL
Gene Name BCDIN3D
Gene Alias -
Gene Description BCDIN3 domain containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BCDIN3D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 144233
Iso type IgG

Enviar un mensaje


BCDIN3D polyclonal antibody

BCDIN3D polyclonal antibody