TCTN2 polyclonal antibody
  • TCTN2 polyclonal antibody

TCTN2 polyclonal antibody

Ref: AB-PAB23456
TCTN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TCTN2.
Información adicional
Size 100 uL
Gene Name TCTN2
Gene Alias C12orf38|FLJ12975|TECT2
Gene Description tectonic family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LGGIVTPKVIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCTN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79867
Iso type IgG

Enviar un mensaje


TCTN2 polyclonal antibody

TCTN2 polyclonal antibody