KIAA0256 polyclonal antibody
  • KIAA0256 polyclonal antibody

KIAA0256 polyclonal antibody

Ref: AB-PAB23455
KIAA0256 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0256.
Información adicional
Size 100 uL
Gene Name KIAA0256
Gene Alias -
Gene Description KIAA0256 gene product
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EEALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISEVNEKEYETNWRNMVETSDGLEASENEKEVSCKHSTSEKPSKLPFDTPAIGKQPSLVATGSTTSATSAGKSTASDK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0256.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9728
Iso type IgG

Enviar un mensaje


KIAA0256 polyclonal antibody

KIAA0256 polyclonal antibody