ALKBH7 polyclonal antibody
  • ALKBH7 polyclonal antibody

ALKBH7 polyclonal antibody

Ref: AB-PAB23454
ALKBH7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALKBH7.
Información adicional
Size 100 uL
Gene Name ALKBH7
Gene Alias MGC10974|SPATA11|UNQ6002
Gene Description alkB, alkylation repair homolog 7 (E. coli)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALKBH7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84266
Iso type IgG

Enviar un mensaje


ALKBH7 polyclonal antibody

ALKBH7 polyclonal antibody