BET1L polyclonal antibody
  • BET1L polyclonal antibody

BET1L polyclonal antibody

Ref: AB-PAB23453
BET1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BET1L.
Información adicional
Size 100 uL
Gene Name BET1L
Gene Alias BET1L1|GOLIM3|GS15|HSPC197
Gene Description blocked early in transport 1 homolog (S. cerevisiae)-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BET1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51272
Iso type IgG

Enviar un mensaje


BET1L polyclonal antibody

BET1L polyclonal antibody