RUFY2 polyclonal antibody
  • RUFY2 polyclonal antibody

RUFY2 polyclonal antibody

Ref: AB-PAB23451
RUFY2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RUFY2.
Información adicional
Size 100 uL
Gene Name RUFY2
Gene Alias FLJ10063|KIAA1537|RABIP4R|ZFYVE13
Gene Description RUN and FYVE domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RUFY2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55680
Iso type IgG

Enviar un mensaje


RUFY2 polyclonal antibody

RUFY2 polyclonal antibody