MRP63 polyclonal antibody
  • MRP63 polyclonal antibody

MRP63 polyclonal antibody

Ref: AB-PAB23450
MRP63 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRP63.
Información adicional
Size 100 uL
Gene Name MRP63
Gene Alias MGC3243|bMRP63
Gene Description mitochondrial ribosomal protein 63
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRP63.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 78988
Iso type IgG

Enviar un mensaje


MRP63 polyclonal antibody

MRP63 polyclonal antibody