INSC polyclonal antibody
  • INSC polyclonal antibody

INSC polyclonal antibody

Ref: AB-PAB23449
INSC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INSC.
Información adicional
Size 100 uL
Gene Name INSC
Gene Alias -
Gene Description inscuteable homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CLQVENEHVLKSMKACVSETLSMLGQHFGQLLELALTREVQALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDSFRCLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INSC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 387755
Iso type IgG

Enviar un mensaje


INSC polyclonal antibody

INSC polyclonal antibody