CAPRIN2 polyclonal antibody
  • CAPRIN2 polyclonal antibody

CAPRIN2 polyclonal antibody

Ref: AB-PAB23447
CAPRIN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CAPRIN2.
Información adicional
Size 100 uL
Gene Name CAPRIN2
Gene Alias C1QDC1|EEG-1|EEG1|FLJ11391|FLJ22569|KIAA1873|MGC102894|MGC134847|MGC134848|caprin-2
Gene Description caprin family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPKPRENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVHQPVGSSSTLPKDPVLRKEKLQDLMTQIQGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CAPRIN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65981
Iso type IgG

Enviar un mensaje


CAPRIN2 polyclonal antibody

CAPRIN2 polyclonal antibody