C11orf45 polyclonal antibody
  • C11orf45 polyclonal antibody

C11orf45 polyclonal antibody

Ref: AB-PAB23445
C11orf45 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf45.
Información adicional
Size 100 uL
Gene Name C11orf45
Gene Alias FLJ43646|MGC35558
Gene Description chromosome 11 open reading frame 45
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219833
Iso type IgG

Enviar un mensaje


C11orf45 polyclonal antibody

C11orf45 polyclonal antibody