RPUSD4 polyclonal antibody
  • RPUSD4 polyclonal antibody

RPUSD4 polyclonal antibody

Ref: AB-PAB23442
RPUSD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPUSD4.
Información adicional
Size 100 uL
Gene Name RPUSD4
Gene Alias FLJ14494
Gene Description RNA pseudouridylate synthase domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPUSD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84881
Iso type IgG

Enviar un mensaje


RPUSD4 polyclonal antibody

RPUSD4 polyclonal antibody