VPS51 polyclonal antibody
  • VPS51 polyclonal antibody

VPS51 polyclonal antibody

Ref: AB-PAB23439
VPS51 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VPS51.
Información adicional
Size 100 uL
Gene Name VPS51
Gene Alias PP5382|ANG2|ANG3|C11orf2|C11orf3|FFR
Gene Description vacuolar protein sorting 51 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VPS51.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 738
Iso type IgG

Enviar un mensaje


VPS51 polyclonal antibody

VPS51 polyclonal antibody