TM9SF3 polyclonal antibody
  • TM9SF3 polyclonal antibody

TM9SF3 polyclonal antibody

Ref: AB-PAB23435
TM9SF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TM9SF3.
Información adicional
Size 100 uL
Gene Name TM9SF3
Gene Alias EP70-P-iso|RP11-34E5.1|SMBP
Gene Description transmembrane 9 superfamily member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TM9SF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56889
Iso type IgG

Enviar un mensaje


TM9SF3 polyclonal antibody

TM9SF3 polyclonal antibody