SUCLA2 polyclonal antibody
  • SUCLA2 polyclonal antibody

SUCLA2 polyclonal antibody

Ref: AB-PAB23428
SUCLA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SUCLA2.
Información adicional
Size 100 uL
Gene Name SUCLA2
Gene Alias A-BETA|SCS-betaA
Gene Description succinate-CoA ligase, ADP-forming, beta subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SUCLA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8803
Iso type IgG

Enviar un mensaje


SUCLA2 polyclonal antibody

SUCLA2 polyclonal antibody