CEP76 polyclonal antibody
  • CEP76 polyclonal antibody

CEP76 polyclonal antibody

Ref: AB-PAB23424
CEP76 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP76.
Información adicional
Size 100 uL
Gene Name CEP76
Gene Alias C18orf9|FLJ12542|HsT1705
Gene Description centrosomal protein 76kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWED
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP76.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79959
Iso type IgG

Enviar un mensaje


CEP76 polyclonal antibody

CEP76 polyclonal antibody