DMXL2 polyclonal antibody
  • DMXL2 polyclonal antibody

DMXL2 polyclonal antibody

Ref: AB-PAB23422
DMXL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DMXL2.
Información adicional
Size 100 uL
Gene Name DMXL2
Gene Alias FLJ26672|KIAA0856|RC3
Gene Description Dmx-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TKTSALSAKKDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DMXL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23312
Iso type IgG

Enviar un mensaje


DMXL2 polyclonal antibody

DMXL2 polyclonal antibody