CHID1 polyclonal antibody
  • CHID1 polyclonal antibody

CHID1 polyclonal antibody

Ref: AB-PAB23421
CHID1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHID1.
Información adicional
Size 100 uL
Gene Name CHID1
Gene Alias FLJ42707|GL008|MGC3234|SI-CLP
Gene Description chitinase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHID1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 66005
Iso type IgG

Enviar un mensaje


CHID1 polyclonal antibody

CHID1 polyclonal antibody