DCUN1D2 polyclonal antibody
  • DCUN1D2 polyclonal antibody

DCUN1D2 polyclonal antibody

Ref: AB-PAB23416
DCUN1D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DCUN1D2.
Información adicional
Size 100 uL
Gene Name DCUN1D2
Gene Alias C13orf17|FLJ10704|FLJ20092
Gene Description DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DCUN1D2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55208
Iso type IgG

Enviar un mensaje


DCUN1D2 polyclonal antibody

DCUN1D2 polyclonal antibody