HVCN1 polyclonal antibody
  • HVCN1 polyclonal antibody

HVCN1 polyclonal antibody

Ref: AB-PAB23414
HVCN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HVCN1.
Información adicional
Size 100 uL
Gene Name HVCN1
Gene Alias HV1|MGC15619|VSOP
Gene Description hydrogen voltage-gated channel 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HVCN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84329
Iso type IgG

Enviar un mensaje


HVCN1 polyclonal antibody

HVCN1 polyclonal antibody