C12orf30 polyclonal antibody
  • C12orf30 polyclonal antibody

C12orf30 polyclonal antibody

Ref: AB-PAB23412
C12orf30 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf30.
Información adicional
Size 100 uL
Gene Name C12orf30
Gene Alias DKFZp667K2112|FLJ13089|MDM20
Gene Description chromosome 12 open reading frame 30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf30.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80018
Iso type IgG

Enviar un mensaje


C12orf30 polyclonal antibody

C12orf30 polyclonal antibody