FGD4 polyclonal antibody
  • FGD4 polyclonal antibody

FGD4 polyclonal antibody

Ref: AB-PAB23406
FGD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FGD4.
Información adicional
Size 100 uL
Gene Name FGD4
Gene Alias CMT4H|DKFZp313E1818|DKFZp434K1572|FLJ34370|FLJ42663|FRABP|MGC57222|ZFYVE6
Gene Description FYVE, RhoGEF and PH domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FGD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 121512
Iso type IgG

Enviar un mensaje


FGD4 polyclonal antibody

FGD4 polyclonal antibody