FGFBP2 polyclonal antibody
  • FGFBP2 polyclonal antibody

FGFBP2 polyclonal antibody

Ref: AB-PAB23405
FGFBP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FGFBP2.
Información adicional
Size 100 uL
Gene Name FGFBP2
Gene Alias HBP17RP|KSP37
Gene Description fibroblast growth factor binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FGFBP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83888
Iso type IgG

Enviar un mensaje


FGFBP2 polyclonal antibody

FGFBP2 polyclonal antibody