MYOZ3 polyclonal antibody
  • MYOZ3 polyclonal antibody

MYOZ3 polyclonal antibody

Ref: AB-PAB23404
MYOZ3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYOZ3.
Información adicional
Size 100 uL
Gene Name MYOZ3
Gene Alias CS-3|CS3|FRP3
Gene Description myozenin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYOZ3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91977
Iso type IgG

Enviar un mensaje


MYOZ3 polyclonal antibody

MYOZ3 polyclonal antibody