MYO7B polyclonal antibody
  • MYO7B polyclonal antibody

MYO7B polyclonal antibody

Ref: AB-PAB23399
MYO7B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYO7B.
Información adicional
Size 100 uL
Gene Name MYO7B
Gene Alias DKFZp686A08248
Gene Description myosin VIIB
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLVLTKKQGLLASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTEPRPEEPPKEKLHTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYO7B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4648
Iso type IgG

Enviar un mensaje


MYO7B polyclonal antibody

MYO7B polyclonal antibody