FAXC polyclonal antibody
  • FAXC polyclonal antibody

FAXC polyclonal antibody

Ref: AB-PAB23398
FAXC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAXC.
Información adicional
Size 100 uL
Gene Name FAXC
Gene Alias C6orf168|dJ273F20
Gene Description failed axon connections homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAXC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84553
Iso type IgG

Enviar un mensaje


FAXC polyclonal antibody

FAXC polyclonal antibody