DNAH10 polyclonal antibody
  • DNAH10 polyclonal antibody

DNAH10 polyclonal antibody

Ref: AB-PAB23391
DNAH10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAH10.
Información adicional
Size 100 uL
Gene Name DNAH10
Gene Alias FLJ38262|FLJ43486|FLJ43808|KIAA2017
Gene Description dynein, axonemal, heavy chain 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAH10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 196385
Iso type IgG

Enviar un mensaje


DNAH10 polyclonal antibody

DNAH10 polyclonal antibody