C14orf80 polyclonal antibody
  • C14orf80 polyclonal antibody

C14orf80 polyclonal antibody

Ref: AB-PAB23387
C14orf80 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf80.
Información adicional
Size 100 uL
Gene Name C14orf80
Gene Alias MGC16771
Gene Description chromosome 14 open reading frame 80
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PAPHMEAEGPVDVRHVQWLMGKLRFRWRQLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQVSGAGAAQNLDLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf80.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283643
Iso type IgG

Enviar un mensaje


C14orf80 polyclonal antibody

C14orf80 polyclonal antibody