BRWD2 polyclonal antibody
  • BRWD2 polyclonal antibody

BRWD2 polyclonal antibody

Ref: AB-PAB23377
BRWD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BRWD2.
Información adicional
Size 100 uL
Gene Name BRWD2
Gene Alias DKFZp434L1715|DR11|FLJ42531|WDR11|WDR15
Gene Description bromodomain and WD repeat domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ILILDLEVNQTVGVIAIERTGVPFLQVIPCFQRDGLFCLHENGCITLRVRRSYNNIFTTSNEEPDPDPVQELTYDLRSQCD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BRWD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55717
Iso type IgG

Enviar un mensaje


BRWD2 polyclonal antibody

BRWD2 polyclonal antibody