PTDSS2 polyclonal antibody
  • PTDSS2 polyclonal antibody

PTDSS2 polyclonal antibody

Ref: AB-PAB23364
PTDSS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PTDSS2.
Información adicional
Size 100 uL
Gene Name PTDSS2
Gene Alias PSS2
Gene Description phosphatidylserine synthase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPDNETDPFHNIWDKLDGF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PTDSS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81490
Iso type IgG

Enviar un mensaje


PTDSS2 polyclonal antibody

PTDSS2 polyclonal antibody