PSPC1 polyclonal antibody
  • PSPC1 polyclonal antibody

PSPC1 polyclonal antibody

Ref: AB-PAB23359
PSPC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSPC1.
Información adicional
Size 100 uL
Gene Name PSPC1
Gene Alias DKFZp566B1447|FLJ10955|PSP1
Gene Description paraspeckle component 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSPC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55269
Iso type IgG

Enviar un mensaje


PSPC1 polyclonal antibody

PSPC1 polyclonal antibody