GTSF1 polyclonal antibody
  • GTSF1 polyclonal antibody

GTSF1 polyclonal antibody

Ref: AB-PAB23356
GTSF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GTSF1.
Información adicional
Size 100 uL
Gene Name GTSF1
Gene Alias FAM112B|FLJ32942
Gene Description gametocyte specific factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GTSF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 121355
Iso type IgG

Enviar un mensaje


GTSF1 polyclonal antibody

GTSF1 polyclonal antibody