PNISR polyclonal antibody
  • PNISR polyclonal antibody

PNISR polyclonal antibody

Ref: AB-PAB23350
PNISR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNISR.
Información adicional
Size 100 uL
Gene Name PNISR
Gene Alias HSPC261|C6orf111|HSPC306|RP11-98I9.2|SFRS18|SRrp130|bA98I9.2
Gene Description PNN-interacting serine/arginine-rich protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQREASGQQSMVEQPPGMMPNGQDMSTMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPPPDQPWMPPTPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGG
Form Liquid
Recomended Dilution Immunofluorescence (1-4 µg/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PNISR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25957
Iso type IgG

Enviar un mensaje


PNISR polyclonal antibody

PNISR polyclonal antibody