TMEM164 polyclonal antibody
  • TMEM164 polyclonal antibody

TMEM164 polyclonal antibody

Ref: AB-PAB23349
TMEM164 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM164.
Información adicional
Size 100 uL
Gene Name TMEM164
Gene Alias FLJ20173|FLJ22679|bB360B22.3
Gene Description transmembrane protein 164
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM164.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84187
Iso type IgG

Enviar un mensaje


TMEM164 polyclonal antibody

TMEM164 polyclonal antibody