LRRC38 polyclonal antibody
  • LRRC38 polyclonal antibody

LRRC38 polyclonal antibody

Ref: AB-PAB23347
LRRC38 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC38.
Información adicional
Size 100 uL
Gene Name LRRC38
Gene Alias RP4-597A16.1
Gene Description leucine rich repeat containing 38
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC38.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126755
Iso type IgG

Enviar un mensaje


LRRC38 polyclonal antibody

LRRC38 polyclonal antibody