FUNDC1 polyclonal antibody
  • FUNDC1 polyclonal antibody

FUNDC1 polyclonal antibody

Ref: AB-PAB23345
FUNDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FUNDC1.
Información adicional
Size 100 uL
Gene Name FUNDC1
Gene Alias MGC51029
Gene Description FUN14 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FUNDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 139341
Iso type IgG

Enviar un mensaje


FUNDC1 polyclonal antibody

FUNDC1 polyclonal antibody