EYA4 polyclonal antibody
  • EYA4 polyclonal antibody

EYA4 polyclonal antibody

Ref: AB-PAB23343
EYA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EYA4.
Información adicional
Size 100 uL
Gene Name EYA4
Gene Alias CMD1J|DFNA10
Gene Description eyes absent homolog 4 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TGGENMTVLNTADWLLSCNTPSSATMSLLAVKTEPLNSSETTATTGDGALDTFTGSVITSSGYSPRSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EYA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2070
Iso type IgG

Enviar un mensaje


EYA4 polyclonal antibody

EYA4 polyclonal antibody