THYN1 polyclonal antibody
  • THYN1 polyclonal antibody

THYN1 polyclonal antibody

Ref: AB-PAB23340
THYN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THYN1.
Información adicional
Size 100 uL
Gene Name THYN1
Gene Alias HSPC144|MDS012|MGC12187|MY105|THY28|THY28KD
Gene Description thymocyte nuclear protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq AFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THYN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29087
Iso type IgG

Enviar un mensaje


THYN1 polyclonal antibody

THYN1 polyclonal antibody