ALKBH8 polyclonal antibody
  • ALKBH8 polyclonal antibody

ALKBH8 polyclonal antibody

Ref: AB-PAB23337
ALKBH8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALKBH8.
Información adicional
Size 100 uL
Gene Name ALKBH8
Gene Alias ABH8|FLJ38204|MGC10235
Gene Description alkB, alkylation repair homolog 8 (E. coli)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALKBH8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91801
Iso type IgG

Enviar un mensaje


ALKBH8 polyclonal antibody

ALKBH8 polyclonal antibody