ATG2A polyclonal antibody
  • ATG2A polyclonal antibody

ATG2A polyclonal antibody

Ref: AB-PAB23335
ATG2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATG2A.
Información adicional
Size 100 uL
Gene Name ATG2A
Gene Alias KIAA0404|MGC117153
Gene Description ATG2 autophagy related 2 homolog A (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKM
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATG2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23130
Iso type IgG

Enviar un mensaje


ATG2A polyclonal antibody

ATG2A polyclonal antibody