TRPT1 polyclonal antibody
  • TRPT1 polyclonal antibody

TRPT1 polyclonal antibody

Ref: AB-PAB23333
TRPT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRPT1.
Información adicional
Size 100 uL
Gene Name TRPT1
Gene Alias MGC11134
Gene Description tRNA phosphotransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRPT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83707
Iso type IgG

Enviar un mensaje


TRPT1 polyclonal antibody

TRPT1 polyclonal antibody