CCDC82 polyclonal antibody
  • CCDC82 polyclonal antibody

CCDC82 polyclonal antibody

Ref: AB-PAB23332
CCDC82 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC82.
Información adicional
Size 100 uL
Gene Name CCDC82
Gene Alias FLJ23518|HSPC048
Gene Description coiled-coil domain containing 82
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DSEEFDSDEELDSDESFENDEELDSNKGPDCNKTPGSERELNLSKIQSEGNDSKCLINSGNGSTYEEETNKIKHRNIDLQDQEKHLSQEDNDLNKQT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC82.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79780
Iso type IgG

Enviar un mensaje


CCDC82 polyclonal antibody

CCDC82 polyclonal antibody