LY6G5C polyclonal antibody
  • LY6G5C polyclonal antibody

LY6G5C polyclonal antibody

Ref: AB-PAB23329
LY6G5C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LY6G5C.
Información adicional
Size 100 uL
Gene Name LY6G5C
Gene Alias C6orf20|G5c|LY6G5CA|LY6G5CB|NG33
Gene Description lymphocyte antigen 6 complex, locus G5C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDYSTPCLFTPGKPSRNPSPWKRTLWT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LY6G5C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80741
Iso type IgG

Enviar un mensaje


LY6G5C polyclonal antibody

LY6G5C polyclonal antibody