HARBI1 polyclonal antibody
  • HARBI1 polyclonal antibody

HARBI1 polyclonal antibody

Ref: AB-PAB23326
HARBI1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HARBI1.
Información adicional
Size 100 uL
Gene Name HARBI1
Gene Alias C11orf77|FLJ32675
Gene Description harbinger transposase derived 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq VIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELM
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HARBI1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283254
Iso type IgG

Enviar un mensaje


HARBI1 polyclonal antibody

HARBI1 polyclonal antibody